PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_AchrUn_randomP21740_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 659aa    MW: 74484.3 Da    PI: 6.1834
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_AchrUn_randomP21740_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS77.62.2e-243154142104
                           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                    ++lL++cA+av+++d+  +++lL+++++++sp+gd++qRla+ f+ +L+arl++++s++y++l++ + +   +++ l+a+
  GSMUA_AchrUn_randomP21740_001 315 ETLLIQCAQAVATDDHPSTNELLKQIRQHSSPHGDANQRLAHWFADGLQARLVGTGSQVYHSLAAYRIP---VTDILKAY 391
                                    579*************************************************************99999...9******* PP

                           GRAS  82 klfsevsPilkfshltaNqaIle 104
                                    +l+  ++P+ k+sh+   q+I++
  GSMUA_AchrUn_randomP21740_001 392 QLYLAACPFRKISHFFSTQTIVN 414
                                    *********************86 PP

2GRAS175.54e-54421610185374
                           GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                                    ++e++++e+L+++++E+l+Vn+ ++  +l+de+v ++s+rd+vLk+v++++P+v+++   +  ++++ Fl+rf eal ++
  GSMUA_AchrUn_randomP21740_001 421 DWETIRVEDLNIDKDEVLVVNCLYRFRNLMDETVLVDSPRDAVLKTVRKINPNVFIHGVLNGTYGAPFFLTRFREALFHF 500
                                    7999**************************************************************************** PP

                           GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkv 344
                                    s +fd++e+++pre+e r+ +E++++gre+ nv++ceg+er+er et+++W++r  +aGF+++pl+ +++k+ak  ++ +
  GSMUA_AchrUn_randomP21740_001 501 SCMFDMIEMTVPREDEPRQLIEKVMFGREALNVISCEGTERVERPETYKRWHARNLRAGFTQLPLNPDIVKKAKNKVKSC 580
                                    ******************************************************************************** PP

                           GRAS 345 ksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                    + + + v e+s++l++gWk+r ++++S W+
  GSMUA_AchrUn_randomP21740_001 581 YHKDFVVVEDSQWLLQGWKGRIIYALSTWK 610
                                    *888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE patternPS0015201625IPR020003ATPase, alpha/beta subunit, nucleotide-binding domain, active site
PROSITE profilePS5098512.838288406IPR005202Transcription factor GRAS
PfamPF035147.6E-22315414IPR005202Transcription factor GRAS
PROSITE profilePS5098523.916407590IPR005202Transcription factor GRAS
PfamPF035141.4E-51421610IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 659 aa     Download sequence    Send to blast
MTASNHTGLF DLQSIPAVHT LDSTSDSSAV FGTGMDGGFS YGLFTEENAL SSLDLGEPQP  60
FSNLPDVHPG FSPSVSTPNS NLVPSLSVST KVDVLEDSEI FSDIVLNYIE RMLMEENIDE  120
KFDVYPEHPA LRVAEKPFYE ILGEKFRHSA DQPSSWPYDP IEYSQLQAHP VSLLSTLTAP  180
DFVTESQPAW QFQRGVEEAR KFLPSADRLV VNLEADEQPV HPARGRKNPH GEDLDTEGRS  240
NKQSAVFIEE TLRTEMFDDV LLCNGENCAK GVNELRLKLQ NQASKISQIC HSKGSSGGGR  300
GRGKNQSKRE VVDFETLLIQ CAQAVATDDH PSTNELLKQI RQHSSPHGDA NQRLAHWFAD  360
GLQARLVGTG SQVYHSLAAY RIPVTDILKA YQLYLAACPF RKISHFFSTQ TIVNLRMTGI  420
DWETIRVEDL NIDKDEVLVV NCLYRFRNLM DETVLVDSPR DAVLKTVRKI NPNVFIHGVL  480
NGTYGAPFFL TRFREALFHF SCMFDMIEMT VPREDEPRQL IEKVMFGREA LNVISCEGTE  540
RVERPETYKR WHARNLRAGF TQLPLNPDIV KKAKNKVKSC YHKDFVVVED SQWLLQGWKG  600
RIIYALSTWK SNRYSASVHF LILQVRLGIC LFGETYQYLY SKQVSSVNCL KNFVPCDGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009387894.10.0PREDICTED: scarecrow-like protein 9
TrEMBLM0UB820.0M0UB82_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP21740_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-139GRAS family protein